How To Cut A Rectangle Cake? - Coffee House and Pastries

Starting about 2 inches from the outer edge of your cake, cut a round circle. this … 2. Slice outer circle into approximately 1 1/2 in. pieces. 3. If your cake is larger than 8 inches in diameter, continue this process of cutting 2 in. circles, then slicing those outer circles until a 6 in. cake remains.

How do you cut a round cake in half?

Cut the cake into three slices. Leave the right slice whole, then cut the middle slice in half. Cut the half in half. With the left slice, cut one quarter diagonally from the top and another quarter from the bottom.

Should you cut your cake into triangles or rectangles?

It’s hip to be rectangle — at least when it comes to cutting cakes. Although you probably spent your formative years watching your parents slice your birthday cake into triangles, mathematician and writer Alex Bellos is here to tell you that’s not the way to do it.

How to cut a sheet cake?

To cut a sheet cake into neat, even pieces, it takes a bit of prep. You will need to know the size of the cake and the number of people you want to serve. You can even create a guide on top of the cake to help you get even cuts. Then, just take your knife, slice, and serve. To get even cleaner cuts, you can even use dental floss.

What’s the best way to slice a cake without breaking it?

It turns out that strong, thin floss, or in this case, fishing line is a fantastic tool to slice through cake cleanly. Use clean, sturdy fishing line, and be sure to cut yourself a piece that’s long enough. (It should be at least as long as the diameter of the cake plus 4′, approximately.)

How do you cut a 9×13 cake?

For a 13×9 Pan: On the long side of the pan, make a mark and cut down every 2 1/10-inches, so you have 6 columns. Turn the pan to its shorter side and make one cut down the middle, 4 ½-inches from the edge. You’ll end up with 12 2 1/10×4 ½-inch rectangles.

How do you cut a full sheet cake?

How to Cut Sheet Cakes

Using a knife with a long, thin blade, vertically cut your cake in half.
Then, vertically cut your halves in half, leaving you with four long sections.
Starting from either end of the cake, press the blade into the cake and pull it away.

How many pieces do you cut a 9×13 cake?

It’s baked in a standard 9-by-13-inch cake pan. This is a perfect size for parties, and you can expect to get between 12 and 20 slices from a single cake. There are three standard ways you can slice this cake: For 12 Slices: Cut the short side into three equal parts and the long side into four equal parts.

Do you cut cake in half hot or cold?

The layers you’d like to cut should be chilled, as a cold cake is much sturdier than a cake at room temperature. I like to bake my cake layers the day before and store them in the fridge.

How many slices of cake are in a sheet cake?

A quarter sheet cake has up to 12 servings. A half sheet cake has up to 24 servings. A full sheet cake has up to 48 servings.

How do you cut a heart out of a square cake?

Leave the square cake whole. Cut the round cake in half, to make two half-circles. With the square cake oriented as a diamond, place the flat side of each half-circle against each of the top sides of the square cake to make a heart shape. Trim slightly, if needed.

How do you cut a cake without it crumbling?

A thin blade, like a tomato knife, is best, but a serrated bread knife also works. Use a gentle sawing motion to cut. (Here’s how to keep your knives sharp.) Cooling the cake and frosting makes both sturdier and less likely to squish, tear or crumble.

What is the best way to cut a round cake?

According to Wilton, the best way to cut a round cake is to first cut a round circle about 2 inches in from the outer edge of the cake. Then you cut that outer circle into pieces that are about 1 1/2 inches. This leaves you with a round cake that is 6 inches, and that you will just cut into slices.

What kind of knife do you use to cut cake?

We found serrated knives performed better than chef’s knives when cutting cake; they made neater slices with fewer frosting smears. Another plus? With a serrated knife, you can use a gentle sawing motion so the knife moves through the cake without compressing each slice.

Should you cut your cake into triangles or rectangles?

How far from the edge of a cake do you cut?

Rather than trying to eyeball the centerpoint of the cake and cut radiuses, with the grid method you need only estimate about two inches from the edge of the cake to start cutting slices. “This way you get the most slices and it’s also the easiest,” explains Wilk.

Easy Cutting Hacks To Make Number Cakes

Cakes with numbers on them! This is the ideal way to commemorate your special day! With a few easy cake cuts, you can make any occasion, such as an anniversary, graduation, or birthday, even more memorable.

Number 1 Cake

Items:

One 9×9 square cake

Instructions:

Using the indicated lines, cut the cake into slices.Make a horizontal layer with the left piece below the center piece.Then, using the top right piece, lay it horizontally over the center piece (cut side facing left), and then place the bottom right piece on top of that, also facing the same direction as the middle piece.Because the number one, by coincidence, looks like a giraffe, we iced it with yellow buttercream and added a few fondant touches, and voila, we had a cute little giraffe smash cake, perfect for a first birthday celebration!

Number 2 Cake

Items:

One 9 inch circle cake
One pound cake

Instructions:

Make a circle in the center of the cake using a sharp knife (we recommend using a glass or a really big cookie cutter).Remove the centre section, and then slice the lower left-hand quadrant of the chicken.Place the poundcake on the bottom of the quarter once it has been turned over.Our cake was iced with blue buttercream, and we then used m&ms to make a rainbow on top of the cake.We built small clouds out of jumbo and not-so-giant marshmallows.

It was a lot of fun.A rainbow would be incomplete without a pot of gold, so we threw some chocolate coins in the mix at the bottom.

Number 3 Cake

Items:

Two 9 inch bundt cakes

One bundt cake should be cut in half, and the other should have the top left quarter cut out of it. Keep your leftovers in a safe place. Place the halved one on top of the quartered one to complete the stack. We decorated our cake with green icing, sour belts, gummies, and pocky sticks to create a very hungry caterpillar that you’ll be even more eager for once you bite into it.

Number 4 Cake

Items:

One 9 x 12 rectangle cake

Slice the cake into three equal pieces.The right slice should be left whole, and then the center slice should be split in half as well.Using a half-inch knife, cut the half in two.Making use of the left slice, cut a quarter diagonally from the top of the pie and a quarter diagonally from the bottom.Remove the two diagonal quarters as well as one of the center middle cuts from the pile.

Using the other center cut, position it to the right of the right slice on the cutting board.Then work your way down the center piece, connecting it to the left piece at the top.Connect the bottom of the left piece to the near bottom of the right piece by using the center piece as a connector.Pouring vanilla buttercream through a round piping tip and piping small dollops all over the cake gave the cake the appearance of a four-in-one.A pink and purple star tip mane, fondant ornaments, and an eyelash completed this sassy uni-four-n look.

Number 5 Cake

Items:

One 9×9 square cake
One 9-inch circle cake

Cut the square cake into three pieces, halving the central slice, and set the remaining two portions aside.Remove the right slice as well as one of the centre pieces from the pan.Then, using a glass, cut a hole in the center of the circular cake and a quarter-circle out of the upper right quadrant.Both should be discarded.To do this, first bring down the left slice and link it to a circle, then rotate the middle piece horizontally and attach it to a circle as well.

Using chocolate frosting and cake crumbs (from the abandoned cake pieces!), we created a bourgeois dirtcake, which we decorated with pirouette biscuits to make a garden wall around the perimeter.Afterwards, we mashed in strawberries to make them appear like patches of grass, and sprinkled on some candy pebbles and gummy worms to make it look more like a dirt cake rather than a ″Grandma’s Fine China Garden Party″ cake.

Number 6 Cake

One 9-inch circle cake
one pound cake

Remove the center and a little portion of the upper left corner using a sharp knife. Then, using the pound cake as a connector, attach it to the sliced corner. This is the simplest of the numbers. To decorate our 6 stage alarm fire engine, we used red icing, pretzels for a ladder, oreos for wheels, and licorice hose. We had a blast!

Number 7 Cake

Items:

One 9-inch square cake

Just kidding, this is the simplest of the challenges!Make three slices, and then cut the center slice in half diagonally in the middle.Remove the right slice from the pan.Horizontally flip the left slice up and link it to the other two slices on each side of it.In order to create our ″Seven Seas″ cake, we coated the bottom leg with blue buttercream and the top leg with yellow buttercream and graham cracker crumbs, as seen below.

We added swedish fish and Teddy Grahams with lifesaving gummy inner tubes to the water to make it seem more like the ocean.We utilized fruit roll ups to adorn the beach by cutting them into squares and using them as sunbathing towels for the Teddy Graham children.

Number 8 Cake

Cut out the centers of the round cakes, and then slice two corners of the cakes to make triangles. Glue the cakes together. We created an 8-race circuit by covering the cake with black icing, piped some green grass, and using Good N Plenty candies to create the lines on the road between the corners. Combine this with some hot wheels and you’re ready to go!

Number 9 Cake

This is the 6th cake, except it has been turned upside down.In recognition of the fact that Pluto is a planet (ohanameansfamily), we at So Yummy decided to create a galaxy cake out of the number nine in order to commemorate all nine planets in the solar system.We started with a base of black frosting and then swirled in blue and purple icing before sprinkling it with white food coloring to make it seem more festive.Add some candy planets and star sprinkles for a dessert that will take you to another planet!

Number 0 Cake

Using a sharp knife, cut the pound cake in half.Cut a hole in the center of the round cake and then cut the cake in two.Fill up any gaps between the circular halves with the pound cake halves that remain after you have separated them.We opted to bake a pineapple cake, which we decorated with yellow frosting piped through a little star tip all over the top and sides of it.After that, simply pipe on a smiling face and some leaves to finish it off.

If you’ve been cutting cake into triangles, you’ve been doing it wrong

It’s fashionable to be a rectangle these days – at least when it comes to cake cutting.According to mathematician and writer Alex Bellos, you undoubtedly spent your childhood seeing your parents slice your birthday cake into triangles, but it isn’t the best way to go about your birthday celebration.To demonstrate why cake should be sliced into rectangles, Bellos is featured in a YouTube video created by Numberphile (Brady Haran) and uploaded to YouTube.Bellos credits a letter to the editor in a December 1906 issue of the scientific magazine Nature with inspiring him to come up with this ground-breaking concept.Using this ″scientific″ procedure, the cake should remain fresher for a longer period of time.

The way it works is as follows:

1. Cut the cake in half.

2. Make another cut next to the first one, also straight down the middle, to create a rectangle.

3. Remove the rectangle you just created.

4. Push the remaining two halves of the cake back together.

5. Place a rubber band around the cake and make another cut down the middle, cutting the cake into fourths.

6. Make another cut next to the one you just made to create a rectangle again. The resulting rectangle slice will have two pieces.

7. Repeat this process until you end up with a plate full of rectangle slices.

This method’s most advantageous feature is that by pressing the remaining halves together, the leftover cake will keep fresh for longer, since it will not dry out in the centre as a result of the pressing action. The complete video may be seen here:

How to Cut a Sheet Cake

Article to be downloaded article to be downloaded A sheet cake may be sliced in almost any way you choose, depending on your preferences.Getting correctly proportioned sheet cake pieces, on the other hand, is a another issue.It takes a little planning ahead of time to cut a sheet cake into clean, equal pieces.You’ll need to know the size of the cake as well as the number of individuals that will be attending the party.You may even draw a guide on the top of the cake to assist you in cutting the cake evenly.

Then all you have to do is take your knife and slice it up and serve it.You may even use dental floss to achieve even cleaner cuts if you want to go even farther.

Decide on the size of your cake in Step 1. Even though a real sheet cake is 16 by 24 by 2 inches (40.6 inches by 61.0 inches and 5.1 centimeter), sheet cakes and sheet cake pans are also available in half and quarter sizes. Look on the package of your sheet cake or sheet cake pan to find the cake size. This will tell you how many servings you may expect to receive.
2 Determine the serving size based on the number of individuals that will be in attendance. Sheet cakes may be cut into a variety of sizes with relative ease. Typically, a sheet cake slice is either 1 in × 2 in (2.5 cm × 5.1 cm), 2 in × 2 in (5.1 cm × 5.1 cm), or 2 in × 3 in (5.1 cm × 7.6 cm). Prepare your cake by estimating the amount of visitors you intend to serve it to and then cutting it appropriately. Please remember that the bigger the pieces of bread are, the less portions you will receive. It will make 54, 24, or 18 servings from a quarter sheet cake
108, 54, or 36 servings from a half sheet cake
and 192,96,64 serves from a full sheet cake (depending on the size of the sheet cake).

Promotional material
3 Place your cake on a non-slip surface to avoid slipping. Prepare a stable platform for your cake so that it will not slip when you are cutting it. It is best not to place your cake straight on a smooth tabletop or counter top. Instead, place a cutting board mat or a large dish towel on the table to protect your cake from falling over. If your cake was delivered on or was decorated on a cake board, do not remove the board from the cake box. Instead, combine the movement of the cake with the board.
If your cake did not arrive with a cake board, you will need to transfer it to a bigger cutting board or cake stand before you can serve it. Keep your cake away from your mat or towel
instead, use a cake stand.

4 Before cutting your cake, score it to serve as a guide for cutting. Using a flat spatula or butter knife, score the top of your cake before cutting it into pieces. A ruler should be placed down the long edge of your cake. Gently insert the blunt end of the dull side of your knife or spatula into the top of the cake every 2 in (5.1 cm). In the following step, slide your ruler to the breadth side of your cake and draw markings at intervals of 1 in (2.5 cm), 2 in (5.1 cm), or 3 in (7.6 cm), depending on the serving size you choose. It is not essential to score the game. Prior to cutting, it is just a simple tool to guarantee that you receive even slices. In the absence of a scoring tool, you will have to rely on your judgment and approximate measurements, and you may not achieve an equal cut.
It is important not to press down too forcefully. You just need to make a little indentation in the top of your cake or icing to serve as a guide when you cut the cake or frosting
Making your cake’s score may be done in advance of your event, saving you from having to spend extra time in the kitchen preparing it.

1Use a long, thin knife to cut the meat. Because of the form of a sheet cake, you will need a longer knife to cut all the way through it completely. Select a knife with a long, thin blade for this task. Avoid using knives with serrated edges, as this may cause the icing to get sloppy. 2Wipe your knife down between each cut to prevent it from becoming sloppy. Using a dish towel or a paper towel, wipe off the blade of your knife in between each cutting motion. This helps to keep your cake pieces crisp, which is especially beneficial if your cake has icing on it.
3 Slice vertically along your scoring line to create a score. Place your blade along one of the two outermost scoring lines on your scorecard. Press the knife against the cake board or cutting board until it makes contact. After that, carefully drag your knife down the whole length of the cake. Wait until you have dragged the knife out of the cake entirely before bringing it back up. Repeat this procedure for the remaining vertical scores in your collection. As long as your knife has enough length to reach across the entire length of the cake, lay it down along its entire length before pressing the entire blade down into the cake and dragging it out
if your knife does not have enough length to reach across the entire cake, start at the top edge and press your blade down at a 45 degree angle until the tip hits the board. Then, using your knife, carefully drag it along the length of the cake.

4Using the horizontal scores, cut separate slices from the sheet of paper. After you’ve made your initial vertical cut, use your horizontal scores to cut individual cake slices from the rest of the cake layer. As you work your way around the outside of the cake, push your knife down at a 45-degree angle until its tip makes contact with the board. Then, with your knife, pull it toward you until it comes out of the cake.
5Serve your dessert. Drag your blade over the bottom of the cake slice to separate it from the remainder of the cake with the flat of your blade. Then, simply put your slice onto a serving platter and cut it into slices to serve. If your piece of cake is extremely resistant, you may need to use a fork to assist transfer it onto the plate. Advertisement

1Use dental floss that has no taste. Flavored floss may leave an aftertaste on your cake slices if eaten in large quantities. Look for dental floss that does not have any flavoring. Fishing wire may also be used instead of floss if you don’t have any on hand.
2Cut a string of floss that is about 4 in (10 cm) longer than your cake. To ensure that you have enough floss to wrap around your fingers, make sure your floss is slightly longer than your cake. Cut a length of floss that is approximately 4 in (10 cm) longer than the length of your cake.
3Wrap the floss around your index fingers, leaving about 2 in (5.1 cm) of space on either side for wrapping the floss. Wrap the ends of the floss around the index and middle fingers of your hands. Make two or three twisting motions with the floss over each finger finger before pulling it straight. Using your fingers, press the floss down evenly down the length of the cake. Line up your floss with the first vertical score line on your board and press your floss down evenly until it touches the board’s surface. Then, using one finger, unwrap your floss from the package. Pull the still-wrapped finger away from the cake and away from the frosting until the floss is entirely free. This procedure should be repeated for each of your score lines.

5Be sure to switch up your floss between each cut. Each scoring line requires a fresh length of floss, which should be swapped out between each score. This will ensure that your cake slices are neat and clean. Advertisement

Inquire about something There are 200 characters remaining. Include your email address so that you may be notified when this question has been resolved. Advertisement submissions are welcome. Thank you for submitting a suggestion for consideration!

About This Article

Using a spatula or a butter knife, score the surface of a sheet cake to form a guideline for cutting, as shown in the illustration.Then, when you’re ready to cut, use a long, thin knife to get the job done.Make sure you have a towel nearby so you can wipe off the knife between each slice, which will help to keep your slices crisp.Start at the outer edge of the cake and slowly press the knife into the cake until the tip of the knife touches the board.Continue reading for advice on how to cut your cake using flavorless dental floss.

Did you find this overview to be helpful?Thank you to all writers for contributing to this page, which has been viewed 34,572 times so far.

The best way to cut cake

One of the most exhilarating experiences a baker may have is removing the first piece of a towering layer cake from the pan.With any hope, the slice will be smoothly removed, revealing the lovely layers that lie underneath.Although this happens occasionally, too often when you cut a cake, the slices wind up coated with icing and covered with crumbs.The final presentation of your lovely layer cake should be spectacular, especially after you’ve spent hours perfecting it.You may now obtain that flawless appearance on a consistent basis.

We offer all of the equipment, techniques, and tips you’ll need to cut a cake perfectly every time.You can find them right here.Let’s start with the most important piece of equipment for the job: the tools you’ll need to cut neatly through cake pieces.

Cake cutting tools

If you grimace at the sight of a cake that has been carelessly cut, a tomato knife is the instrument you need.Yes, it comes in helpful when slicing finely fresh tomatoes.But what is its less well-known function?Perfectly slicing the cake!It was the first time I used this narrow knife to slice our Classic Birthday Cake that I literally burst out laughing as I took the first slice and saw that there was not a crumb out of place!

The tomato knife has serrated teeth that are relatively broad in comparison to the rest of the blade.This tool effortlessly cuts through icing and cake layers with little effort.It also has a razor-sharp edge despite having a limited breadth and shallow depth.The fact that there isn’t a lot of surface area for the knife to absorb icing and then drag it through the remainder of the cake makes it great for cutting cake.It’s worthwhile to spend the money on this reasonably priced knife because it’s the ideal instrument for cutting cake.

Serrated vs. chef’s knife

If you are unable to obtain a tomato knife, you will need to use another serrated knife that is somewhat short in blade length.A blade that is between 5″ and 8″ in length is the most manageable.Some people may go toward a straight-edged chef’s knife, believing that its sharp blade and generally lengthy reach will be the most effective for their needs.Our testing has shown us that this is not the case.When it came to cutting cake, we discovered that serrated blades performed better than chef’s knives; they produced cleaner slices with less icing stains.

What’s another plus?By sawing through the cake with a serrated knife, you may ensure that each slice is not compressed while cutting with a serrated knife.It’s possible that with a chef’s knife, you’ll wind up pressing down on the cake and creating a dense, smushed slice of cake.Don’t get me wrong, it’s still tasty — it’s just not nearly as visually appealing as you may have thought.

Techniques

Now that you’ve determined which knife is the greatest for the job, let’s talk about some of the tactics you may use to cut cake flawlessly in the future.

Quick chill

The majority of people like to eat cake at room temperature.However, don’t be afraid to chill your cake for a short period of time before slicing it.A brief cool in the refrigerator for around 10 to 15 minutes will assist to set the icing on your cake.When you slice a knife through the frosting, it is less likely to splatter since it is somewhat cold.Because there is a limited resting period, the cake will not get completely cooled for the duration of the event.

Furthermore, after the cake pieces have been served, they will heat up rapidly.If you want to be absolutely certain that the slices have lost their coolness, wait approximately 5 minutes after the slices have been plated before serving.

Hot water is your friend

If you have the luxury of time before cutting your cake, you may make slicing even simpler by running your knife under hot water before using it.To cut your slices, make sure the knife is completely dry before cutting them while the knife is still somewhat warm to the touch.It will cut through the icing like butter if you use a heated knife.The slices will be nice and tidy, with all of the icing remaining precisely where it should be on the cake.

Clean your knife between slices

You should always wipe the knife clean between slices, regardless of whether you’ve refrigerated the cake or warmed up your knife beforehand.As you cut a cake, it is natural for the knife to acquire icing and crumbs (this is true even for a tomato knife to some extent).However, if you allow the icing to accumulate, your knife is more likely to snag and smear.After each slice, wipe the knife with a kitchen towel or sponge to remove any remaining residue.Once you’ve done that, watch your knife glide effortlessly through the cake!

Tricks

You already know which knife to use and how to produce the greatest cuts; now we’ll teach you a few additional tips and tactics that are well worth having in your arsenal.

Fishing line

If you’ve ever heard of using dental floss to slice things like cinnamon buns or cheesecake, you won’t be surprised by this technique.After all, it turns out that strong and thin floss (in this case, fishing line) is a terrific instrument for slicing neatly through cake.Utilize clean, durable fishing line and be sure to cut yourself a length that is long enough to reach your destination.(It should be at least as long as the circumference of the cake plus 4″, to give you a ballpark idea.) Make light markings in the icing before cutting your cake so that the slices will have a guideline to follow while cutting.This guarantees that you’ll end up with the appropriate number of slices that are equally sliced.

Keep a firm grip on the line in each of your hands when you’re ready to cut.Exert downward pressure on the line with your thumbs while keeping it taut in order to bring it all the way through the cake.As soon as you’ve reached the bottom, just let go with one hand and draw the line out of one side of the cake and into another.Using a damp cloth, wipe the line clean if any frosting has gathered before making the next cut.

Clean (or cover up) any mess

Even if you use the proper tool and make your cuts as carefully as possible, you may still wind up with icing stains or wayward crumbs on your cake.Relax in these situations!Even with icing smudges on the surface of the cake, it will still taste delicious.However, if you’re a type A baker (like I am), you might want to consider investing in a pair of tweezers for your kitchen.They come in helpful if you’re desperate to have picture-perfect slices on your plate..

Pluck off any frosting-stained crumbs or pieces of cake that aren’t quite right until you’re happy with the result.Is there a simpler (and maybe more tasty) alternative?Make some ice cream or whipped cream and put it on top of your cake to make it a la mode!Your visitors will be so engrossed in tasting the multilayered dessert that they will not even notice a crumb that has been lost in the layers.

Cut cake flawlessly

You can slice your cake like a master whether you’ve created our Recipe of the Year (Classic Birthday Cake) or another outstanding layer cake by following our instructions.Keep in mind to use a tiny, sharp serrated knife and a delicate sawing motion when cutting the paper.If you have the luxury of time, chill your cake before warming your knife and wiping it clean between cuts.You have a number of tricks under your sleeve if the situation calls for them.When you cut your next cake with confidence, you’ll hear oohs and ahhs as you lift the first piece away from the pan.

39.9M views

Discover short videos related to how to cut a rectangle cake on TikTok.Watch popular content from the following creators: MEL(@rastamelanie), Megan Mallory Babuska(@meganmallorybabuska), chefkecik(@chefkecikkitchen), Nuzkitchen(@nuzkitchen), fit_mentally_first(@fit_mentally_first). Explore the latest videos from hashtags:howtocutacake,howtocutcake,rectanglecake,cake_cut,howtodecorateacupcake,howtodecoratecupcakes,cut_to_cut.

meganmallorybabuska

Megan Mallory Babuska

473.7K views

71.7K Likes, 1K Comments. TikTok video from Megan Mallory Babuska (@meganmallorybabuska): ″Anyway you slice it, it’s cake.caketokhowtobakerylife″. 1. Classic Triangle | 5 Ways to Slice Your Cake| 2. Rectangles |. Dirty Thoughts.

Dirty Thoughts

chefkecikkitchen

chefkecik

42.3K views

1.4K Likes, 16 Comments. TikTok video from chefkecik (@chefkecikkitchen): ″Part 3: How we coating Rectangle Cake. Enjoy!fypfyppbakingtiktokbakermalaysiacakedecoratingbakingfoodloverfoodiesbakingtips″. Infinity.

Infinity

fit_mentally_first

2185 views

TikTok video from fit_mentally_first (@fit_mentally_first): ″Reply to @ele88_321another rectangle cakeviraltrendingsatisfyingcakeasmrforyoucakecuttinbirthdaycakecuttingfyp″. Let’s cut two slices in a row of the rectangle Black Forrest Cake with the famous cake cutter, you flip the cake around for the second slice. I had a square cake cutter but it broke. SUGAR, SUGAR.

SUGAR, SUGAR

rastamelanie

MEL

2000 views

95 Likes, 13 Comments. TikTok video from MEL (@rastamelanie): ″How she cut a rectangular cake! My sister is a different kind special!fypfamilymoms @konsciouskirk″. how would they know bad girls club.

how would they know bad girls club

nuzkitchen

Nuzkitchen

3152 views

TikTok video from Nuzkitchen (@nuzkitchen): ″Best way to cut your cakecakedecoratingcakehackcuttingcaketiktokviralcaketipsBOSSMovesThatNewLookFeeling″. This is a 6” cake you can get 16 rectangular slices or 32 small squares by cutting the rectangle slices in half. This is the best way to cut any cake to maximise servings!. love nwantiti (feat. ElGrande Toto).

love nwantiti (feat. ElGrande Toto)

rectanglecake

3.1M views

rectanglecake Hashtag Videos on TikTok

Rectanglecake | This video has had 3.1 million views. On TikTok, you may see short films about rectanglecake. See all of the videos

howtocutacake

28.8M views

howtocutacake Hashtag Videos on TikTok

There have been 3.1 million views of Rectanglecake. Rectanglecake TikTok videos are short, entertaining videos that showcase the cake. Browse through all of the videos

howtocutcake

7.3M views

howtocutcake Hashtag Videos on TikTok

Howtocutcake | This video has had 7.3 million views. On TikTok, you may see short movies about how to cut a cake. See all of the videos

howtodecoratecupcakes

5173 views

howtodecoratecupcakes Hashtag Videos on TikTok

Howtodecoratecupcakes | This video has been viewed by 5.2K people. On TikTok, you may see short movies about how to decorate cupcakes. See all of the videos

cut_to_cut

44.8K views

cut_to_cut Hashtag Videos on TikTok

Cut to cut | 44.8K people have viewed this video so far. On TikTok, you may see short films about cut to cut. See all of the videos Download the TikTok application. TikTok may be downloaded by scanning the QR code with your camera. Send yourself a text message with a link to TikTok’s download page.

How to Cut a Cake

The most recent update was made on June 23, 2018.Anyone who has ever been in charge of cutting a cake understands how stressful it can be in such a circumstance.Cutting a cake may be more stressful than actually constructing and decorating one, for a variety of reasons ranging from destroying the look of your icing to resulting in unevenly proportioned slices.Unfortunately for you, we have included an instructional video and step-by-step instructions on how to cut a cake for you to watch and learn from.

How to Choose Your Knife

Slicing knives are ideal for cutting through each cake as it is assembled.You will, however, want to choose a distinct edge style for each of the cakes.For example, because fragile cakes, such as pound or angel food, must be sliced in a sawing motion, you’ll want to use a slicing knife with a serrated edge while cutting them.Cakes with a smooth edge can be cut with a knife for the remainder of the recipes mentioned below.

How to Clean Your Knife

It is critical that you thoroughly clean your knife blade between each cut, no matter what sort of knife you are using to cut the cake.Non-only does this help to maintain the final aspect of your frosting, but it also makes it easier to cut each piece out.Before you begin cutting, place the blade of your knife in a container of warm water for a brief period of time.It is critical that the water is warm, as this will aid you in cutting into your cake more easily.Then, using a towel, blot out any remaining excess water.

Immediately after making your initial cut, you’ll want to dip the blade of your knife back into the water and stir it around to remove any crumbs or icing that have accumulated on the blade.Once more, grab your towel and wipe the blade clean and dry.

Step-by-Step Instructions

How to Cut Delicate Cakes

It is essential to have the blade of your knife somewhat moist and warm before making your initial cut since delicate cakes are typically sticky.
Make sawing motions through your cake with a sharp slicing knife with a serrated edge.
2. Decide on the size of your cake piece
3.
Once more, carefully saw into your cake
4.Using the flat side of your blade, take up a slice of cake from the bottom and serve using the flat side of your blade.

How to Cut Layered Cakes

Instead of using your hands to contact the cake, use a cake stand with a cutting board pad for gripping the cake.
Place the pie or cake marker on top of the cake with care, using a pie or cake marker
2.This will leave markings on the surface that you may use as a guide for cutting later on.
3.In one of the designated lines, press down with a thin, long-bladed knife to make a mark.
After the knife has gone through the cake completely, carefully remove it away from the cake.
5.After that, use your knife and draw a line to the left or right of your initial cut
Pull the knife aside from where it was pressed down into the indicated line a second time
Using a pie server, slide the bottom of the slice beneath the top of the slice and serve

How to Cut Sheet Cakes

Instead of using your hands to contact the cake, use a cake stand with a cutting board pad for gripping the cake.
1.Using a knife with a long, thin blade, cut your cake in half vertically
2.
2.After that, split your halves in half vertically, so that you have four long portions.
Using either end of the cake as a starting point, press down on the blade and draw it away from the cake.
4.Do this until you have five slices from one of your quarters
then repeat the process.
When you’re ready to serve, slip the flat side of your blade beneath the bottom of your slice.
Repeat steps 4, 5, and 6 for the remaining three quarters.

How to Cut Dense Cakes

Instead of using your hands to contact the cake, use a cake stand with a cutting board pad for gripping the cake.
Cutting your cake in half with a thin, long blade is an excellent first step.
2.After that, split your halves in half, so that you have four portions of similar size
While we cut four thin slices into each quarter, the size of the slices is entirely up to you
nevertheless, we recommend that you use a sharp knife.
Using one of the quarters, begin to cut it in two.
4.When you’ve reached the bottom of the cake, press the blade down and peel away from the cake.
Continue with the preceding steps for the remaining quarters.
In order to serve, slip the flat side of your blade below the bottom of your slice.
If you want to obtain 16 pieces out of your cake, you may do so by halving the halves from your quarters and cutting them in half again.

How Many Cake Slices Will You Get From a Cake?

Knowing how many pieces to expect when preparing a cake for a birthday party or other special event is important when planning a cake for a crowd.The number of servings is determined by the size of the pieces you cut as well as the type and size of the cake you choose to make.The usual servings per cake might assist you in determining the form of cake to create in order to ensure that everyone of your guests receive a piece of cake.Example: If you’re having a party, a huge rectangle cake will provide the most servings, whereas round cakes are ideal for smaller gatherings such as a dinner party.

Rectangular Cake

When it comes to homemade cake recipes, the most frequent shape is a huge rectangle. It’s prepared in a 9-by-13-inch cake pan, which is normal. You may anticipate to acquire between 12 and 20 pieces from a single cake of this size, which makes it ideal for gatherings and celebrations. Generally speaking, there are three typical methods to slice this cake: To make 12 slices, divide the short side into three equal halves and the long side into four equal sections on each sides. Those are some rather enormous portions of cake.
To make 15 slices, divide the short side into three sections and the long side into five sections. Cake in the normal size is being served here
To make 20 slices, divide the short side into four halves and the long side into five sections on each sides. When you only need a few extra pieces to feed all of your guests, this is the cut to use.

Square and Round Cakes

Square and round baking pans are used for smaller cakes and are available in 8-inch and 9-inch sizes, respectively. The size of this dish makes it ideal for family dinners and small gatherings. When served in a single layer, square cakes are often sliced into square pieces with three or four cuts along each length. In the case of circular cakes, you may either bake them in a single layer or bake them in two layers and put icing between them. When constructing a double-layer cake, make the sections a little thinner so that the serving size isn’t too enormous when sliced into slices. Square Single-Layer Cake can be cut into 9 to 16 slices
round single-layer cake can be cut into 8 to 10 pieces
round double-layer cake can be cut into 12 to 16 slices.

Angel Food and Bundt Cake

These cakes are prepared on special circular cake pans with a hollow center, which are designed specifically for this purpose.The regular angel food cake pan has a diameter of 10 inches and is designed to accommodate an ordinary cake stand.Bundt cake pans are available in a variety of sizes, which are commonly measured in cups: The normal pan size is a 10-inch, 12-cup baking dish.Expect to receive 12 to 16 slices of cake for either style of cake.

Cheesecake

Cheesecakes are thin and baked on pie plates that are either 9 or 10 inches in diameter. The usual serving size divides the cheesecake into 12 slices that are evenly spaced. You may make up to 16 pieces from a single cheesecake if you cut them a bit thinner than usual.

Wedding and Tiered Cakes

Tiered cakes and bigger sheet cakes are popular for wedding receptions since they are intended to serve a large number of people at one time. In most cases, they are also sliced into smaller pieces as well. How many pieces you may expect from these cakes is determined on the form, size, and number of layers of the cake.

How to cut a cake into even layers

On August 4, 2015, Annalise posted a blog entry (updated April 3, 2020) If you’re hoping to give your layer cake a little additional oomph, adding more cake layers is a terrific method to accomplish your goal.When you cut into a taller cake, you’ll hear more oohs and aahs from your friends and family as they watch you slice into it.While it is possible to bake each layer separately, you may not have enough cake pans or oven space, in which case cutting cake layers in half horizontally is the best option.It is possible to divide cake layers in half using a variety of methods.You may use a specialized tool, cut them in half using toothpicks, or even use dental floss to divide the layers.

This strategy, on the other hand, is my personal favorite.It is simple, accurate, and does not need the use of expensive equipment.

What you’ll need

You’ll need a tiny paring knife as well as a big serrated knife for this project.The layers you intend to cut should be cooled before cutting, since a chilled cake is considerably more stable than a cake that has been left at room temperature.I prefer to make my cake layers the day before and keep them refrigerated until needed.I also use this approach to bake cakes with flat tops, but if your cake layers have domed tops, you’ll need to cut them out with a serrated knife first before slicing the layers in two as described above.Finally, I like to divide cake layers that are 2 inches or more in thickness rather than cutting them in half (tall).

Cake layers that are thinner might be more challenging to deal with.Let’s get this party started now that you’re ready!

Step 1

Making use of the paring knife, score the whole outside edge of the cake halfway up one side of the cake. Go slowly and carefully, getting down to eye level if necessary, and avoid cutting too deeply. This is just intended to serve as a point of reference.

Step 2

Cut through the cake with the serrated knife, following the depression produced with the paring knife. Once again, move gently to ensure correctness; there is no need to rush this process.

Step 3

Lift the top layer of the cake away from the bottom layer using the knife.Your cake should be strong enough to be lifted easily without buckling or crumbling, but if you’re working with a cake round that is bigger than 8 or 9 inches in diameter or cake layers that are exceedingly thin, you may need to take a little more precaution.Use the separated layers right away to assemble a layer cake, or wrap them separately in plastic wrap and keep them in the refrigerator for up to 5 days or in the freezer (double-wrapped) for up to 1 month in the refrigerator or freezer.

baking simplified 4 Baking Tips the Pros Know

Subscribe today and you’ll receive the following brief instructions in your inbox:

How Many Sheet Cakes And Servings Calculator

Published on the 4th of October, 2017. This calculator will assist you in determining the size and quantity of sheet cake you may require based on the number of attendees attending your event. It will also include a breakdown of the calories for various serving sizes. This can help you determine whether or not you will have enough cake for a wedding, birthday party, or other event. You may also alter serving sizes to match your budget. Sheet cakes are normally available in three sizes: quarter, half, and full sheets. A quarter sheet measures 9′′x13′′, a half sheet measures 13′′x18′′, and a full sheet measures 18′′x26′′. In most cases, sheet cakes are 2 inches in height. The number of servings provided by each cake is determined by the size of the serves. Servings per sheet cake are determined by the number of equally sized slices that can be cut, according to the International Dairy Deli Bakery Association and Cake Central. For a 1′′x2′′ serving, a quarter sheet cake has up to 54 servings, a half sheet cake has up to 108 servings, and an entire sheet cake has up to 192 servings.

For a 2′′x2′′ serving, use the following measurements: There are as many servings in a quarter sheet cake as there are in a half sheet cake
a full sheet cake has as many serves as there are in a complete sheet cake.

For a 2′′x3′′ serving, use the following measurements: A quarter sheet cake can hold up to 18 servings, a half sheet cake can hold up to 36 servings, and a full sheet cake can hold up to 64 servings.

In order to make a dish measuring 2′′x3′′, follow these steps: Quarter sheet cakes may serve up to 18 people, half sheet cakes can serve up to 36 people, and a full sheet cake can serve up to 64 people.

How to Make a Heart-Shaped Cake

Instructions on how to bake a heart-shaped cake are simple to follow! It’s the perfect gift for Valentine’s Day!

Make a Heart-Shaped Cake for Valentine’s Day! No heart pan needed!

This is a straightforward and entertaining method of creating a huge heart-shaped cake.Dessert for Valentine’s Day that is simple!Also, make sure to check out the DIY Valentine’s Day ideas that we have been developing!If you don’t want to indulge in sugar this holiday season, we’ve got you covered with exciting non-candy alternatives!Utilize your favorite cake mix flavor or your favorite cake recipe to create this dessert.

It is possible to use the cake mix method to improve the quality of the cake mix.It is best to use recipes that make a 9-inch-round cake or two 8-inch-round cakes for this heart cake.This Red Velvet Cake Recipe is a fantastic choice!Make use of an 8-inch square baking pan as well as an 8-inch circular cake pan.Although a square metal cake pan is ideal, I use whatever I have on hand since it does the job!

You may use these amazing cake strips around each pan to help create a more smooth and even surface for your cake.Whenever I know that I’ll be taking a cake from a pan, I want to make sure that the cake does not stick to the pan.Using parchment paper to line the bottom of each pan is an excellent idea, as is spraying the pans and paper with Baker’s Joy Baking Spray or combining butter and flour to coat the pans and paper.Place the pan on the parchment paper and trace around the bottom of the pan to ensure that the parchment paper is the correct size.

Make cuts along the inside of your traced line to finish off your project.Using a sharp knife, cut the round cake in half to form two half-circles once it has cooled completely.Keep the square cake intact, but turn it so that it is oriented like a diamond.Then, to form a heart shape, lay the flat side of each half-round against the top edges of the diamond.If the round cake does not fit nicely with the square cake, just cut the edges of the round cake.Take pleasure in the trimmings as well!

Fortunately, the icing hides the cake seams as well as the rest of the cake.
And while we’re on the subject of frosting, this is an absolutely wonderful cream cheese icing!
Tip for Cake Decorating: If you want your icing to be more white in color, use clear vanilla extract instead of regular vanilla extract.
Despite the fact that I am not a skilled cake designer, I am aware that applying a crumb coat of frosting to a cake of this nature is a good idea.

Then apply a good, neat final coat of icing on top of everything.By using this strategy, you may keep the cake crumbs contained to the first layer of the cake.Using an offset or angled spatula makes it incredibly simple to spread evenly!Add sparkles, candies, or whatever else you want to make it look beautiful!BetterRecipes.com provided the inspiration for this heart-shaped cake.

The Cook’s Illustrated Cookbook contains a recipe for cream cheese frosting.

We’ve got lots of other delicious Valentine’s Day Recipes for you to check out too:

Luxury Red Velvet Cake Roll Recipe
Amazing Frosted Sugar Cookie Bars Recipe
Cupid’s Crunch Recipe
Lemony Love Potion Recipe
Valentine’s Day Pink Strawberry Chocolate Chip Cookies
Valentine’s Day Chocolate Chip Cookies

Get tried and true and EASY recipes delivered to your inbox! Subscribe to our weekly recipe email.

8-inch round cake pan
8-inch square cake pan

Cake

1 box Red Velvet cake mix, or any cake mix (except angel food), or your favorite 9-inch-square cake recipe.

Cream Cheese Frosting

12-ounce cream cheese, melted
6-ounce unsalted butter, softened
4 teaspoons sour cream
1 teaspoon vanilla extract (use clear vanilla if you want your frosting to be more white)
12 teaspoons confectioners’ sugar
14 teaspoon salt
1 34 cup powdered sugar (7 ounces)
1 34 cup butter

Preheat the oven according to the directions on the cake mix packaging.
Remove the parchment paper from the square 8-inch pan and cut another piece to fit the interior of the bottom of a circular 8-inch cake pan. Cooking spray should be sprayed into the center of each pan before placing the parchment paper into the pans to help hold the parchment in place. Then coat each pan and piece of parchment paper with a flour-based nonstick cooking spray, such as Baker’s Joy. If you like, you may butter and flour each pan separately.
Prepare the cake mix according to the directions on the package. Divide the batter evenly between the two pans that have been prepared. Bake according to package directions. Allow to cool in pans for 10 minutes before carefully removing from pans and allowing to cool completely on cooling racks.
Prepare the frosting in a food processor or mixer until it is smooth and creamy. Combine the cream cheese, butter, sour cream, vanilla, and salt in a large mixing bowl until thoroughly blended. As required, scrape down the edges of the dish. Mix in the powdered sugar until it is light and fluffy
Leave the square cake in its whole. Make two half-circles out of the round cake by dividing it in half. Place the flat side of each half-circle against each of the top edges of the square cake, with the square cake orientated as a diamond. This will create a heart form with the square cake. If necessary, make minor adjustments. The icing will hide the seams and other imperfections
Spread a thin layer of icing over the entire cake to serve as a crumb coat (to keep cake crumbs from appearing in the final layer of frosting). Then, using a second and final coat of frosting, cover the whole cake. Decorate to your liking

How to Cut a Cake Like a Pro

Every editorial product is chosen on its own merits, while we may be compensated or earn an affiliate commission if you purchase something after clicking on one of our affiliate links. As of the time of writing, the ratings and pricing are correct, and all goods are in stock.

Here’s how to cut a round cake properly, with even slices and no messy crumbs.

You’ve accomplished your goal: you’ve cooked a beautiful multi-tiered cake and applied a silky, dreamy coating of icing to top it off.(Alternatively, you might have gone to the bakery and purchased a cake of professional quality.) After that, you’ll have to deal with the ultimate party trick: cutting the cake.Slicing a cake without spreading frosting or scattering crumbs, or dishing up a mixture of thick and thin pieces, can be tricky.Some expert recommendations for cutting a round cake precisely every time are provided below.Our decadent layer cake recipes can transform every gathering into a celebration.

How to Cut a Round Cake Neatly

Several easy approaches will put you in the best possible position for success: Make use of a serrated knife.Although it appears that a straight blade would be cleaner, a serrated blade is actually more effective in cutting through cake.It is recommended to use a thin blade, such as a tomato knife, although a serrated bread knife will also work.To cut, use a delicate sawing motion with your fingers.(See this page for instructions on how to maintain your blades sharp.) Refrigerate the cake for 10-15 minutes before serving.

Cake and frosting that have been allowed to cool are more durable and less prone to collapse, break, or crumble.Because you don’t want the cake to become too chilly before serving, a brief trip to the refrigerator is sufficient.Which of these typical cake blunders are you doing right now?Every slice should be made with a hot, clean knife.Before making your first cut, properly clean and dry the knife by running it under hot water.

After each slice, wipe the knife clean with a clean cloth, then run it under hot water and dry it well.It may take a bit longer, but a heated knife will cut through icing more neatly and efficiently.

A Trick for Cutting Even Slices

When slicing a round cake, it’s quite simple to wind up with slices that are all different sizes—this is not desirable!Prepare the cake by marking a line down the centre with a piece of fishing line or dental floss before you begin to cut.Turn around 90 degrees and draw the midway line once more.You should now have an X in the center of the cake; each slice should come to a stop at this point.Also included are four quarters of the cake, which makes it simple to determine how large to cut the cake pieces to serve your guests after they have been cut out by the lines.

If you’re feeding 16, for example, split each quarter of the cake into four slices per person.Slices should be around 1′′ to 1.5′′ broad in general.Recently, Taste of Home announced the debut of its own bakeware collection.Make a cake in one of our 9-inch round cake pans.

How to Remove The First Piece

Even if your slice is in perfect condition, it might be difficult to remove the initial slice from the serving plate.It’s all too easy to forget to put the tip of the slice back on—or to remove the icing off the slice next to you.Run your knife along both sides of the slice quickly to ensure that it has been sliced fully through the slice.Afterwards, slide a spatula underneath the slice and push it on the plate.Smoothly raise your body.

The use of an offset spatula, which has an angled handle, makes it simpler to reach completely beneath the slice of cake.If you don’t get it the first time, don’t be too stressed about it.The good news is that even if your cake is sliced unevenly or the icing is smeared, it is still cake, and cake is always a positive thing in my opinion.Keep a can of whipped cream on hand in case you need to cover up a minor fault quickly.Test out these show-stopping layer cakes from Taste of Home magazine!

Sandy’s Chocolate Cake

Years ago, I traveled 4-and-a-half hours to enter a cake contest, the entire while carrying my submission in my lap. But it was worth it. You’ll understand why this silky beauty was called the greatest chocolate cake recipe and earned first place after just one mouthful! Sandra Johnson, of Tioga, Pennsylvania, sent in this message. Recipes may be obtained by clicking here.

Majestic Pecan Cake

This dish is a true testament to its title. The three-layer cake with pecan dots is topped with homemade frosting, which is baked from scratch and decorated with edible flowers. Karen R. Jones of Claypool, Indiana, sent in this letter.

Malted Chocolate & Stout Layer Cake

Looking for a St. Patrick’s Day dessert that will blow everyone away? Look no further! With a great malt taste and a juicy texture, this decadent chocolate cake is well matched by the creamy Irish cream icing. Jennifer Wayland, of Morris Plains, New Jersey, contributed to this article.

Best Red Velvet Cake

When this festive dessert doesn’t materialize, it’s just not Christmas in our household. The frosting on this cake is unlike any other red velvet cake recipe I’ve tried before; it’s as light as snow. —Kathryn Davison from the city of Charlotte, North Carolina

Chocolate Spice Cake with Caramel Icing

I discovered this recipe in the late 1980s and immediately recognized it as a remarkable cake. Due to the fact that you must work fast, the caramel frosting might be a bit challenging, but it is well worth it! Marion James of Ferguson, Missouri sent in this message.

Chocolate Hazelnut Torte

The majority of cake recipes serve a large number of people. As a result, we created this lovely small cake that feeds six people. Just enough for two people, with just the proper amount of leftovers! — Test Kitchen for Taste of Home

Black Walnut Layer Cake

The recipe for this exquisite cake was given to me by my sister many years ago. The thin coating of icing applied on the exterior of the cake gives it a sleek, contemporary appearance. The following is a letter from Lynn Glaze of Warren, Ohio

Moist Chocolate Cake

Because it was one of my grandmother’s specialties, this chocolate cake recipe with coffee brings back fond memories of her.I make it for family gatherings on a regular basis, and it always brings back pleasant memories.The cake is light and fluffy, with a delightful chocolate flavor that will leave you wanting more.This is a keeper of a recipe!—Patricia Kreitz from Richland, Pennsylvania.

Butter Pecan Layer Cake

This cake has the same delicious flavor as the famous butter pecan ice cream flavor, thanks to the addition of pecans and butter. • Becky Miller, from Tallahassee, Florida

Cherry Nut Cake

This is a recipe that my grandma created for her children. She came up with a recipe that everyone enjoyed, using cherries and walnuts from the Ozarks. Granny usually used cream from a dairy farm near her home, but half-and-half works just as well and is much more convenient to get by these days. Dianna Jennings lives in Lebanon, Missouri and writes:

Favorite Coconut Cake

Whenever I’m looking for a show-stopping dessert for a big event, this is the recipe I reach for. My guests are grateful that I do! Edna Hoffman of Hebron, Indiana, sent this message.

Strawberry Mascarpone Cake

Please don’t be deceived by the amount of stages in this recipe; it is simple to put together. While baking, the cake rises to a high and fluffy level, and the berries impart a fresh fruity flavor. If you don’t have any mascarpone cheese on hand, cream cheese may be used as an alternative. Carol Witczak, of Tinley Park, Illinois, contributed to this article.

Marvelous Marble Cake

The greatest marble cake is made using pound cake and chocolate. The fo